• • DRAMP ID

  • DRAMP18106

• • Peptide Name

  • U1-theraphotoxin-Ba1b (U1-TRTX-Ba1b; Venom peptide 2)

• • Source

  • Brachypelma ruhnaui (Mexican golden redrump tarantula) (Brachypelmaalbiceps)

• • Family

  • Belongs to the huwentoxin-2 family

• • Gene

  • Not found

• • Sequence

  • IFECVFSCDIKKEGKPCKPKGEKKCTGGWRCKIKLCLKI

• • Sequence Length

  • 39

• • UniProt Entry

  • P85504

• • Protein Existence

  • Protein level

• • Biological Activity

  • Insecticidal

• • Target Organism

  • Insect LD50=9.2 ± 0.9 μg/g

• • Hemolytic Activity

  • • No hemolysis information or data found in the reference(s) presented in this entry

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • Not found

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Nonterminal Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • Beta sheet (3 strands; 10 residues)

• • Structure Description

  • The three-dimensional conformation (Fig. 3B) of Ba2 consists in a three-stranded (residues 15–17, 29–32 and 35–38) anti-parallel beta-sheet. The first strand is connected with the second one by a large loop made of residues 19–28, whereas the second and third strands are connected by a β-turn.

• • Helical Wheel Diagram

  • 

• • PDB ID

  • 2KGH resolved by NMR

• Predicted Structure

• There is no predicted structure for DRAMP18106.

DRAMP18106

• • Function

  • Has insecticidal activity.

• ·Literature 1

• • Title

  • Insecticidal peptides from the theraposid spider Brachypelmaalbiceps: an NMR-based model of Ba2.

• • Pubmed ID

  • 19374957

• • Reference

  • BiochiM. BiophyS. Acta 1794:1190-1196 (2009).

• • Author

  • Corzo G., Bernard C. , Clement H., Villegas E., Bosmans F., Tytgat J., Possani L.D., Darbon H., Alagon A.