• DRAMP ID

    • DRAMP18107
    • Peptide Name

    • U1-theraphotoxin-Ba1a (U1-TRTX-Ba1a; Venom peptide 1)
    • Source

    • Brachypelma ruhnaui (Mexican golden redrump tarantula) (Brachypelmaalbiceps)
    • Family

    • Belongs to the huwentoxin-2 family
    • Gene

    • Not found
    • Sequence

    • ILECVFSCDIKKEGKPCKPKGEKKCTGGWRCKIKLCLKI
    • Sequence Length

    • 39
    • Protein Existence

    • Protein level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18107 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18107.
    • Formula

    • C195H333N53O50S6
    • Absent Amino Acids

    • AHMNQY
    • Common Amino Acids

    • K
    • Mass

    • 4412.47
    • PI

    • 9.36
    • Basic Residues

    • 11
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +7
    • Boman Index

    • -5031
    • Hydrophobicity

    • -0.341
    • Aliphatic Index

    • 77.44
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5875
    • Absorbance 280nm

    • 154.61
    • Polar Residues

    • 12

DRAMP18107

DRAMP18107 chydropathy plot
    • Function

    • Has insecticidal activity.
  • ·Literature 1
    • Title

    • Primary structure of two insecticidal peptides from the theraposid Brachypelma ruhnaui.
    • Reference

    • Submitted (FEB-2008) to UniProtK
    • Author

    • Corzo G., Clement H., Alagon A.