General Information

    • DRAMP ID

    • DRAMP18109

    • Peptide Name

    • U2-ctenitoxin-Cs1a (U1-CNTX-Cs2a; Neurotoxic enhancer CSTX-13; U1-ctenitoxin-Cs2a; Fragments)

    • Source

    • Cupiennius salei (Wandering spider)

    • Family

    • Belongs to the spider toxin CSTX superfamily

    • Gene

    • Not found

    • Sequence

    • SDCTLRNHDCTDDRHSCCRSKMFKDVCTCFYPSQAKKELCTCQQPKHLKYIEKGLQKAKDYAT

    • Sequence Length

    • 63

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • Fly (LD50=16.3 pmol/mg)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18109 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18109.

Physicochemical Information

    • Formula

    • C310H494N92O97S9

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • KC

    • Mass

    • 7350.43

    • PI

    • 8.66

    • Basic Residues

    • 15

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +7

    • Boman Index

    • -10000

    • Hydrophobicity

    • -0.97

    • Aliphatic Index

    • 40.32

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 4970

    • Absorbance 280nm

    • 80.16

    • Polar Residues

    • 22

DRAMP18109

DRAMP18109 chydropathy plot

Comments Information

    • Function

    • This toxin alone has very weak insecticidal activity, with an unknown molecular target. Acts as a neurotoxic enhancer, synergistically enhancing the neurotoxic action of omega-CNTX-Cs1a (CSTX-1) (AC P81694).

Literature Information

  • ·Literature 1

    • Title

    • CSTX-13, a highly synergistically acting two-chain neurotoxicenhancer in the venom of the spider Cupiennius salei (Ctenidae).

    • Reference

    • ProC. Natl. Acad. Sci. U.S. A. 101:11251-11256 (2004).

    • Author

    • Wullschleger B., Kuhn-Nentwig L., Tromp J., Kaempfer U., Schaller J., Schuerch S. , Nentwig W.
  • ·Literature 2

    • Title

    • Spider venom: enhancement of venom efficacy mediated by different synergistic strategies in Cupiennius salei.

    • Reference

    • J. Exp. Biol. 208:2115-2121 (2005).

    • Author

    • Wullschleger B., Nentwig W., Kuhn-Nentwig L.