General Information

    • DRAMP ID

    • DRAMP18110

    • Peptide Name

    • Omega-hexatoxin-Ar1a (Omega-HXTX-Ar1a; Omega-atracotoxin-Ar1a; Omega-AcTx-Ar1a)

    • Source

    • Atrax robustus (Sydney funnel-web spider)

    • Family

    • Belongs to the omega-atracotoxin type 1 family

    • Gene

    • Not found

    • Sequence

    • SSVCIPSGQPCPYNEHCCSGSCTYKENENGNTVQRCD

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • House crickets (LD50=236±28 pmol/g)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18110 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18110.

Physicochemical Information

    • Formula

    • C381H600N110O129S7

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • G

    • Mass

    • 4011.35

    • PI

    • 4.83

    • Basic Residues

    • 8

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 25

    • Net Charge

    • -3

    • Boman Index

    • -10000

    • Hydrophobicity

    • -0.192

    • Aliphatic Index

    • 68.82

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 39.94

    • Polar Residues

    • 34

DRAMP18110

DRAMP18110 chydropathy plot

Comments Information

    • Function

    • Insecticidal toxin that reversibly and voltage- independently blocks both mid-low- (M-LVA) and high-voltage- activated (HVA) calcium channels (Cav) in cockroach DUM neuronS. Also causes a modest block of insect sodium channel currents (Nav). Induces potent excitatory symptoms, followed by flaccid paralysis leading to death in house cricketS. Miscellaneous

Literature Information

  • ·Literature 1

    • Title

    • The omega-atracotoxins: selective blockers of insect M-LVA and HVAcalcium channelS.

    • Reference

    • BiocheM. Pharmacol. 74:623-638 (2007).

    • Author

    • Chong Y., Hayes J.L., Sollod B., Wen S. , Wilson D.T., Hains P.G., Hodgson W.C. , Broady K.W., King G.F., Nicholson G.M.