• DRAMP ID

    • DRAMP18111
    • Peptide Name

    • Mu-hexatoxin-Mg2a (Mu-HXTX-Mg2a; Neurotoxin magi-3)
    • Source

    • Macrothele gigas (Spider)
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GGCIKWNHSCQTTTLKCCGKCVVCYCHTPWGTNCRCDRTRLFCTED
    • Sequence Length

    • 46
    • Protein Existence

    • Protein level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • site 3 of the insect voltage- gated sodium channel (Nav)
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18111 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP18111.
    • Formula

    • C216H337N67O65S10
    • Absent Amino Acids

    • AM
    • Common Amino Acids

    • C
    • Mass

    • 5233.06
    • PI

    • 8.4
    • Basic Residues

    • 8
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +5
    • Boman Index

    • -8829
    • Hydrophobicity

    • -0.354
    • Aliphatic Index

    • 38.04
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 13115
    • Absorbance 280nm

    • 291.44
    • Polar Residues

    • 25

DRAMP18111

DRAMP18111 chydropathy plot
    • Function

    • Competes for binding at site 3 of the insect voltage- gated sodium channel (Nav). Insecticidal neurotoxin. Causes temporary paralysis to lepidopteran larvae when injected at 10.3 nmol/g. Is not toxic to mice when injected intracranially at 20 pmol/g.##PTM
  • ·Literature 1
    • Title

    • Distinct primary structures of the major peptide toxins from thevenom of the spider Macrothele gigas that bind to sites 3 and 4 in thesodium channel.
    • Reference

    • FEBS Lett. 547:43-50 (2003).
    • Author

    • Corzo G., Gilles N., Satake H., Villegas E., Dai L., Nakajima T., Haupt J.