General Information

    • DRAMP ID

    • DRAMP18112

    • Peptide Name

    • Mu-hexatoxin-Mg1b (Mu-HXTX-Mg1b; Neurotoxin magi-1)

    • Source

    • Macrothele gigas (Spider)

    • Family

    • Belongs to the magi-1 family

    • Gene

    • Not found

    • Sequence

    • CMGYDIHCTDRLPCCFGLECVKTSGYWWYKKTYCRRKS

    • Sequence Length

    • 38

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • site 4 of the insect voltage- gated sodium channel (Nav)

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18112 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18112.

Physicochemical Information

    • Formula

    • C203H303N55O54S7

    • Absent Amino Acids

    • ANQ

    • Common Amino Acids

    • C

    • Mass

    • 4602.4

    • PI

    • 8.86

    • Basic Residues

    • 8

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -7165

    • Hydrophobicity

    • -0.534

    • Aliphatic Index

    • 38.42

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 17335

    • Absorbance 280nm

    • 468.51

    • Polar Residues

    • 18

DRAMP18112

DRAMP18112 chydropathy plot

Comments Information

    • Function

    • Insecticidal neurotoxin. Shows competition for site 3 of insect voltage-gated sodium channels (Nav). Has no effect on lepidopteran larvae when injected at 20 pmol/g, or on mice when injected intracranially at 32.8 nmol/g.

Literature Information

  • ·Literature 1

    • Title

    • Distinct primary structures of the major peptide toxins from thevenom of the spider Macrothele gigas that bind to sites 3 and 4 in thesodium channel.

    • Reference

    • FEBS Lett. 547:43-50 (2003).

    • Author

    • Corzo G., Gilles N., Satake H., Villegas E., Dai L., Nakajima T., Haupt J.