General Information

    • DRAMP ID

    • DRAMP18113

    • Peptide Name

    • Delta-amaurobitoxin-Pl1b (Delta-AMATX-Pl1b; Delta-palutoxin IT2; Delta-paluIT2)

    • Source

    • Pireneitega luctuosa (Tangled nest spider) (Paracoelotes luctuosus)

    • Family

    • Belongs to the beta/delta-agatoxin family

    • Gene

    • Not found

    • Sequence

    • ACVGDGQRCASWSGPYCCDGYYCSCRSMPYCRCRNNS

    • Sequence Length

    • 37

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • Insect LD50=24.7 ± 11.8 mg/g

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • beta sheet (5 strands; 10 residues)

    • Structure Description

    • The three-dimensional structure of δ-paluIT2 consists of a compact disulfide-bonded core, from which four loops emerge.In δ-paluIT2, the corresponding loops encompass residues 3–6 (loop I), 10–15 (loop II), 18–20 (loop III), and 25–31 (loop IV), and residues 7–9 are involved in an extended structure. The β-sheet structure is therefore made of three anti-parallel β-strands (Q7–R8, Y21–S24, and R32–N35 ).

    • Helical Wheel Diagram

    • DRAMP18113 helical wheel diagram

    • PDB ID

    • 1V91 resolved by NMR

    • Predicted Structure

    • There is no predicted structure for DRAMP18113.

Physicochemical Information

    • Formula

    • C165H245N53O54S9

    • Absent Amino Acids

    • EFHIKLT

    • Common Amino Acids

    • C

    • Mass

    • 4123.62

    • PI

    • 8.21

    • Basic Residues

    • 4

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 4

    • Net Charge

    • +2

    • Boman Index

    • -8716

    • Hydrophobicity

    • -0.56

    • Aliphatic Index

    • 13.24

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11960

    • Absorbance 280nm

    • 332.22

    • Polar Residues

    • 23

DRAMP18113

DRAMP18113 chydropathy plot

Comments Information

    • Function

    • Insecticidal toxin. Lethal to lepidopteran larvae. No adverse affects when intracerebroventricularly injected in mice at a dose of 0.2 ug but causes reversible paralysis of legs when injected intracerebroventricularly in mice at a dose of 2.0 ug. Binds to site 4 of insect voltage-gated sodium channel (Nav) and inhibits channel inactivation.

Literature Information

  • ·Literature 1

    • Title

    • Isolation, synthesis and pharmacological characterization of delta-palutoxins IT, novel insecticidal toxins from the spider Paracoelotesluctuosus (Amaurobiidae).

    • Reference

    • Eur. J. BiocheM. 267:5783-5795 (2000).

    • Author

    • Corzo G., Escoubas P., Stankiewicz M. , Pelhate M. , Kristensen C. P., Nakajima T.
  • ·Literature 2

    • Title

    • A spider toxin that induces a typical effect of scorpion alpha-toxinsbut competes with beta-toxins on binding to insect sodium channelS.

    • Reference

    • Biochemistry 44:1542-1549 (2005).

    • Author

    • Corzo G., Escoubas P., Villegas E., Karbat I., Gordon D., Gurevitz M. , Nakajima T., Gilles N.
  • ·Literature 3

    • Title

    • Solution structure of two insect-specific spider toxins and their pharmacological interaction with the insect voltage-gated Na+channel.

    • Reference

    • Proteins 59:368-379 (2005).

    • Author

    • Ferrat G., Bosmans F., Tytgat J., Pimentel C. , Chagot B., Gilles N., Nakajima T., Darbon H., Corzo G.