• DRAMP ID

    • DRAMP18117
    • Peptide Name

    • U2-segestritoxin-Sf1a (U2-SGTX-Sf1a; F5.6; Toxin SFI 1)
    • Source

    • Segestria florentina (Tube-web spider) (Segestria gracilis)
    • Family

    • Belongs to the spider toxin SFI family
    • Gene

    • Not found
    • Sequence

    • KECMTDGTVCYIHNHNDCCGSCLCSNGPIARPWEMMVGNCMCGPKA
    • Sequence Length

    • 46
    • Protein Existence

    • Protein level
    • Biological Activity

    • Insecticidal
    • Target Organism

    • Heliothis virescens (LD50=10 μg/g)
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18117 helical wheel diagram
    • Predicted Structure

    • There is no predicted structure for DRAMP18117.
    • Formula

    • C201H316N60O64S12
    • Absent Amino Acids

    • FQ
    • Common Amino Acids

    • C
    • Mass

    • 4981.8
    • PI

    • 6.01
    • Basic Residues

    • 5
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 8
    • Net Charge

    • +1
    • Boman Index

    • -5191
    • Hydrophobicity

    • -0.137
    • Aliphatic Index

    • 42.39
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 7490
    • Absorbance 280nm

    • 166.44
    • Polar Residues

    • 22

DRAMP18117

DRAMP18117 chydropathy plot
    • Function

    • Causes flaccid paralysis followed by death when injected into Heliothis virescens larvae. Does not induce any toxic effects when injected intravenously into adult mice at a dose of 1.5 mg/kg body weight. Orally active against larvae of the tomato moth (Laconobia oleracea), the rice brown planthopper (Nilaparvata lugens), and the peach-potato aphid (Myzus persicae) when fused to snowdrop lectin.
  • ·Literature 1
    • Title

    • Novel insecticidal toxins from the venom of the spider Segestriaflorentina.
    • Reference

    • Toxicon 40:125-130 (2002).
    • Author

    • Lipkin A., Kozlov S. , Nosyreva E., Blake A., Windass J.D., Grishin E.
  • ·Literature 2
    • Title

    • Fusion proteins containing insect-specific toxins as pest controlagents: snowdrop lectin delivers fused insecticidal spider venom toxinto insect haemolymph following oral ingestion.
    • Reference

    • J. Insect Physiol. 50:61-71 (2004).
    • Author

    • Fitches E., Edwards M. G., Mee C. , Grishin E., Gatehouse A.M. , Edwards J.P., Gatehouse J.A.