General Information

    • DRAMP ID

    • DRAMP18148

    • Peptide Name

    • Delta-ctenitoxin-Pn2c (Delta-CNTX-Pn2c; Neurotoxin Pn2-5A; Neurotoxin Tx2-5; PNTx2-5)

    • Source

    • Phoneutria nigriventer (Brazilian armed spider) (Ctenus nigriventer)

    • Family

    • Belongs to the spider toxin Tx2 family

    • Gene

    • Not found

    • Sequence

    • ATCAGQDQTCKVTCDCCGERGECVCGGPCICRQGNFLIAWYKLASCKK

    • Sequence Length

    • 48

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Insecticidal

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18148 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18148.

Physicochemical Information

    • Formula

    • C378H614N104O118S11

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • C

    • Mass

    • 5122.98

    • PI

    • 8.12

    • Basic Residues

    • 9

    • Acidic Residues

    • 11

    • Hydrophobic Residues

    • 30

    • Net Charge

    • -2

    • Boman Index

    • -8733

    • Hydrophobicity

    • 0.26

    • Aliphatic Index

    • 88.05

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7615

    • Absorbance 280nm

    • 94.01

    • Polar Residues

    • 27

DRAMP18148

DRAMP18148 chydropathy plot

Comments Information

    • Function

    • Reversible inhibitor of voltage-gated sodium channels (Nav). Delays the fast inactivation kinetics of neuronal-type sodium channelS. Causes scratching, lacrimation, hypersalivation, sweating and agitation followed by spastic paralysis of the anterior and posterior extremities and death at dose levels of 0.24 mg/mouse. Insecticidal to the larval and adult forms of the house fly.

Literature Information

  • ·Literature 1

    • Title

    • Cloning of cDNAS encoding neurotoxic peptides from the spiderPhoneutria nigriventer.

    • Reference

    • Toxicon 36:1843-1850 (1998).

    • Author

    • Kalapothakis E., Penaforte C. L., Beirao P.S. L., Romano-Silva M. A., Cruz J.S. , Prado M. A.M. , Guimaraes P.E.M. , Gomez M. V., Prado V.F.
  • ·Literature 2

    • Title

    • The purification and amino acid sequences of four Tx2 neurotoxinsfrom the venom of the Brazilian 'armed' spider Phoneutria nigriventer (Keys).

    • Reference

    • FEBS Lett. 310:153-156 (1992).

    • Author

    • Cordeiro M. N., Diniz C. R., Valentim A.D.C. , von Eickstedt V.R.D., Gilroy J., Richardson M.
  • ·Literature 3

    • Title

    • Structure and activity analysis of two spider toxins that alter sodium channel inactivation kineticS.

    • Reference

    • Biochemistry 48:3078-3088 (2009).

    • Author

    • Matavel A., Fleury C. , Oliveira L.C. , Molina F., de Lima M. E., Cruz J.S. , Cordeiro M. N., Richardson M. , Ramos C. H., Beirao P.S.
  • ·Literature 4

    • Title

    • Comparison of the partial proteomes of the venoms of Brazilianspiders of the genus Phoneutria.

    • Reference

    • Comp. BiocheM. Physiol. 142:173-187 (2006).

    • Author

    • Richardson M. , Pimenta A.M. , Bemquerer M. P., Santoro M. M. , Bei
  • ·Literature 5

    • Title

    • Isolation of neurotoxic peptides from the venom of the 'armed' spider

    • Reference

    • Toxicon 29:1225-1233 (1991).

    • Author