General Information

    • DRAMP ID

    • DRAMP18184

    • Peptide Name

    • Beta-defensin 42 (BD-42, mBD-42 )

    • Source

    • Mus musculus (Mouse)

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Defb42

    • Sequence

    • SIGNKGISFETCTAIEGLCFFGCKLGWVWIAYCNNIMSCCRKDTDFVLPQTKGI

    • Sequence Length

    • 54

    • Protein Existence

    • Transcript level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18184 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18184.

Physicochemical Information

    • Formula

    • C267H411N67O75S7

    • Absent Amino Acids

    • H

    • Common Amino Acids

    • CGI

    • Mass

    • 5984.02

    • PI

    • 7.52

    • Basic Residues

    • 5

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +1

    • Boman Index

    • -2603

    • Hydrophobicity

    • 0.335

    • Aliphatic Index

    • 79.44

    • Half Life

      • Mammalian:1.9 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12865

    • Absorbance 280nm

    • 242.74

    • Polar Residues

    • 23

DRAMP18184

DRAMP18184 chydropathy plot

Comments Information

    • Function

    • Has bactericidal activity (By similarity). May play a role in the antimicrobial protection of sperm and urogenital tract epithelia. Epididymis-specific, with highest levels in the initial segment and distal caput.

Literature Information

  • ·Literature 1

    • Title

    • Cross-species analysis of the mammalian beta-defensin gene family:presence of syntenic gene clusters and preferential expression in themale reproductive tract.

    • Reference

    • Physiol. Genomics 23:5-17(2005)

    • Author

    • Patil A.A., Cai Y., Sang Y., Blecha F., Zhang G.
  • ·Literature 2

    • Title

    • The transcriptional landscape of the mammalian genome.

    • Reference

    • Science 309:1559-1563(2005)

    • Author

    • Carninci P., Kasukawa T., Katayama S. et al.
  • ·Literature 3

    • Title

    • Lineage-specific biology revealed by a finished genome assembly ofthe mouse.

    • Reference

    • PLoS Biol. 7:E1000112-E1000112(2009)

    • Author

    • Church D.M., Goodstadt L., Hillier L.W. et al.
  • ·Literature 4

    • Title

    • The status, quality, and expansion of the NIH full-length cDNAproject: the Mammalian Gene Collection (MGC).

    • Reference

    • Genome Res. 14:2121-2127(2004)

    • Author

    • The MGC Project Team
  • ·Literature 5

    • Title

    • Discovery and characterization of new epididymis-specific beta-defensins in mice.

    • Reference

    • Biochim. Biophys. Acta 1730:22-30(2005)

    • Author

    • Jalkanen J., Huhtaniemi I., Poutanen M.