General Information

    • DRAMP ID

    • DRAMP18186

    • Peptide Name

    • Beta-KTx-like peptide LaIT2

    • Source

    • Liocheles australasiae (Wood scorpion)

    • Family

    • Belongs to the long chain scorpion toxin family. Class 2 subfamily.

    • Gene

    • Not found

    • Sequence

    • AKKPFVQRVKNAASKAYNKLKGLAMQSQYGCPIISNMCEDHCRRKKMEGQCDLLDCVCS

    • Sequence Length

    • 59

    • Protein Existence

    • Protein level

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18186 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18186.

Physicochemical Information

    • Formula

    • C280H465N85O83S9

    • Absent Amino Acids

    • TW

    • Common Amino Acids

    • K

    • Mass

    • 6638.83

    • PI

    • 9.2

    • Basic Residues

    • 12

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +7

    • Boman Index

    • -11834

    • Hydrophobicity

    • -0.522

    • Aliphatic Index

    • 62.88

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 57.84

    • Polar Residues

    • 18

DRAMP18186

DRAMP18186 chydropathy plot

Comments Information

    • Function

    • Amphipathic peptide that causes significant antimicrobial activity in the growth inhibition assay against E.coli. Causes paralysis or death to crickets within 48 hours after injection at a dose of 1.3 ug/insect (26 ug/g of body weight).

Literature Information

  • ·Literature 1

    • Title

    • Purification and cDNA cloning of LaIT2, a novel insecticidal toxinfrom venom of the scorpion Liocheles australasiae.

    • Reference

    • Biosci. Biotechnol. Biochem. 73:2769-2772(2009)

    • Author

    • Matsushita N., Miyashita M., Ichiki Y., Ogura T., Sakuradani E.,Nakagawa Y., Shimizu S., Miyagawa H.