• DRAMP ID

    • DRAMP18193
    • Peptide Name

    • Cathelicidin-related peptide crotalicidin
    • Source

    • Crotalus durissus terrificus (South American rattlesnake)
    • Family

    • Belongs to the cathelicidin family.
    • Gene

    • Unknown
    • Sequence

    • KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
    • Sequence Length

    • 34
    • Evidence code

    • Unknown
    • Biological Activity

    • Antibacterial, Anti-Gram+, Anti-Gram-, Antimicrobial
    • Target Organism

      • [Ref.25100358]Gram-negative: E.coli ATCC 25922 (MIC=0.25 μg/mL),P.aeruginosa (MIC=1 μg/mL);
      • Gram-positive: E.faecalis (MIC=32 μg/mL), S.aureus (MIC=32 μg/mL).
    • Hemolytic activity

      • [Ref.25100358]10% hemolytic activity at 12.5 µM against red blood cells
    • Binding Target

    • cell membrane
    • Structure

    • alpha helical
    • Structure Description

    • Unknown
    • PDB ID

    • 2MWT resolved by NMR
    • DRAMP18193 helical wheel diagram
    • 2MWT-> 
    • Formula

    • C203H345N53O37S
    • Absent Amino Acids

    • ACDEHNQWY
    • Common Amino Acids

    • K
    • Mass

    • 474113
    • PI

    • 12.66
    • Basic Residues

    • 15
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 13
    • Boman Index

    • -5393
    • Hydrophobicity

    • -43.53
    • Aliphatic Index

    • 80
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 3

DRAMP18193

DRAMP18193 chydropathy plot
    • Function

    • Adopts an amphipathic alpha helical conformation, that may allow to partition into the target membrane (By similarity). Hemolytic activities have been observed on mammalian cells. Expressed by the venom gland.
  • Literature 1
    • Reference

    • Amino Acids 46:2561-2571(2014)
    • Author

    • Falcao C.B., de La Torre B.G., Perez-Peinado C., Barron A.E.,Andreu D., Radis-Baptista G.
    • Title

    • Vipericidins: a novel family of cathelicidin-related peptides fromthe venom gland of South American pit vipers.