• • DRAMP ID

  • DRAMP18193

• • Peptide Name

  • Cathelicidin-related peptide crotalicidin

• • Source

  • Crotalus durissus terrificus (South American rattlesnake)

• • Family

  • Belongs to the cathelicidin family.

• • Gene

  • Not found

• • Sequence

  • KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF

• • Sequence Length

  • 34

• • UniProt Entry

  • U5KJM4

• • Protein Existence

  • Not found

• • Biological Activity

  • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

• • Target Organism

  • • [Ref.25100358]Gram-negative: E.coli ATCC 25922 (MIC=0.25 μg/mL),P.aeruginosa (MIC=1 μg/mL);
    • Gram-positive: E.faecalis (MIC=32 μg/mL), S.aureus (MIC=32 μg/mL).

• • Hemolytic Activity

  • • [Ref.25100358]10% hemolytic activity at 12.5 µM against red blood cells

• • Cytotoxicity

  • • Not included yet

• • Binding Target

  • cell membrane

• • Linear/Cyclic

  • Not included yet

• • N-terminal Modification

  • Not included yet

• • C-terminal Modification

  • Not included yet

• • Other Modifications and Unusual Amino Acids

  • Not included yet

• • Stereochemistry

  • Not included yet

• • Structure

  • alpha helical

• • Structure Description

  • Not found

• • PDB ID

  • 2MWT resolved by NMR
• • 
  • 2MWT-> 

DRAMP18193

• • Function

  • Adopts an amphipathic alpha helical conformation, that may allow to partition into the target membrane (By similarity). Hemolytic activities have been observed on mammalian cells. Expressed by the venom gland.

• ·Literature 1

• • Title

  • Vipericidins: a novel family of cathelicidin-related peptides fromthe venom gland of South American pit vipers.

• • Pubmed ID

  • 25100358

• • Reference

  • Amino Acids 46:2561-2571(2014)

• • Author

  • Falcao C.B., de La Torre B.G., Perez-Peinado C., Barron A.E.,Andreu D., Radis-Baptista G.