• DRAMP ID

    • DRAMP18193
    • Peptide Name

    • Cathelicidin-related peptide crotalicidin
    • Source

    • Crotalus durissus terrificus (South American rattlesnake)
    • Family

    • Belongs to the cathelicidin family.
    • Gene

    • Not found
    • Sequence

    • KRFKKFFKKVKKSVKKRLKKIFKKPMVIGVTIPF
    • Sequence Length

    • 34
    • Protein Existence

    • Not found
    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-
    • Target Organism

      • [Ref.25100358]Gram-negative: E.coli ATCC 25922 (MIC=0.25 μg/mL),P.aeruginosa (MIC=1 μg/mL);
      • Gram-positive: E.faecalis (MIC=32 μg/mL), S.aureus (MIC=32 μg/mL).
    • Hemolytic Activity

      • [Ref.25100358] Crotalicidin reached 10% hemolysis at 25 μM. Even so, extrapolation of existing data indicates that 50% hemolysis would be reached at near-millimolar values, which defines an adequate (~2 log) selectivity window.
    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented
    • Binding Target

    • cell membrane
    • Linear/Cyclic

    • Cyclic
    • N-terminal Modification

    • Free
    • C-terminal Modification

    • Amidation
    • Nonterminal Modifications and Unusual Amino Acids

    • None
    • Stereochemistry

    • L
    • Structure

    • alpha helical
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18193 helical wheel diagram
    • PDB ID

    • 2MWT resolved by NMR
    • Predicted Structure

    • There is no predicted structure for DRAMP18193.
    • Formula

    • C203H345N53O37S
    • Absent Amino Acids

    • ACDEHNQWY
    • Common Amino Acids

    • K
    • Mass

    • 4152.37
    • PI

    • 12.09
    • Basic Residues

    • 15
    • Acidic Residues

    • 0
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +15
    • Boman Index

    • -5393
    • Hydrophobicity

    • -0.435
    • Aliphatic Index

    • 80
    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 3

DRAMP18193

DRAMP18193 chydropathy plot
    • Function

    • Adopts an amphipathic alpha helical conformation, that may allow to partition into the target membrane (By similarity). Hemolytic activities have been observed on mammalian cells. Expressed by the venom gland.
  • ·Literature 1
    • Title

    • Vipericidins: a novel family of cathelicidin-related peptides fromthe venom gland of South American pit vipers.
    • Reference

    • Amino Acids 46:2561-2571(2014)
    • Author

    • Falcao C.B., de La Torre B.G., Perez-Peinado C., Barron A.E.,Andreu D., Radis-Baptista G.