• DRAMP ID

    • DRAMP18195
    • Peptide Name

    • LsbB (Bacteriocin)
    • Source

    • Lactococcus lactis subsp. lactis (Streptococcus lactis)
    • Family

    • Unknow
    • Gene

    • lsbB
    • Sequence

    • MKTILRFVAGYDIASHKKKTGGYPWERGKA
    • Sequence Length

    • 30
    • Evidence code

    • Biological Activity

    • Antibacterial
    • Target Organism

      • targeting primarily lactococcal cells
    • Hemolytic activity

    • Unknown
    • Binding Traget

    • Unknow
    • Structure

    • alpha helical
    • Structure Description

    • Structure determination by NMR spectroscopy showed that LsbB has an N-terminal alpha helix, whereas the C-terminal of the molecule remains unstructured.
    • DRAMP18195 helical wheel diagram
    • 2MLU-> 
    • Formula

    • C156H246N44O40S
    • Absent Amino Acids

    • CNQ
    • Common Amino Acids

    • K
    • Mass

    • 392745
    • PI

    • 10.75
    • Basic Residues

    • 8
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 9
    • Boman Index

    • -5095
    • Hydrophobicity

    • -68.33
    • Aliphatic Index

    • 58.67
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 8480
    • Absorbance 280nm

    • 292.41
    • Polar Residues

    • 9

Amino Acid Distribution

DRAMP18195 chydropathy plot
    • The results indicate that the outmost eight-amino acid sequence at the C-terminal end is likely to contain the receptor binding domain. Alanine substitution revealed that the tryptophan in position 25 (Trp25) is crucial for the blocking activity of the truncated peptides, as well as for the antimicrobial activity of the full-length bacteriocin. 

  • Literature 1
    • Reference

    • J. Biol. Chem. 278:34291-34298(2003).
    • Author

    • Gajic O., Buist G., Kojic M., Topisirovic L., Kuipers O.P., Kok J.
    • Title

    • Novel mechanism of bacteriocin secretion and immunity carried out bylactococcal multidrug resistance proteins.
  • Literature 2
    • Reference

    • J. Biol. Chem. 289:23838-23845(2014)
    • Author

    • Ovchinnikov K.V., Kristiansen P.E., Uzelac G., Topisirovic L.,Kojic M., Nissen-Meyer J., Nes I.F., Diep D.B.
    • Title

    • Defining the structure and receptor binding domain of the leaderlessbacteriocin LsbB.