General Information

    • DRAMP ID

    • DRAMP18255

    • Peptide Name

    • Circularin A(Bacteriocin)

    • Source

    • Clostridium beijerinckii ATCC 25752

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • cirA

    • Sequence

    • VAGALGVQTAAATTIVNVILNAGTLVTVLGIIASIASGGAGTLMTIGWATFKATVQKLAKQSMARAIAY

    • Sequence Length

    • 69

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(broad)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • nonmodified, head-to-tail-ligated cyclic antibacterial peptides

    • Helical Wheel Diagram

    • DRAMP18255 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18255.

Physicochemical Information

    • Formula

    • C305H515N81O88S2

    • Absent Amino Acids

    • CDEHP

    • Common Amino Acids

    • A

    • Mass

    • 6789.05

    • PI

    • 10.46

    • Basic Residues

    • 4

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 37

    • Net Charge

    • +4

    • Boman Index

    • 4198

    • Hydrophobicity

    • 1.007

    • Aliphatic Index

    • 124.64

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 6990

    • Absorbance 280nm

    • 102.79

    • Polar Residues

    • 23

DRAMP18255

DRAMP18255 chydropathy plot

Comments Information

    • digestion products of circularin A are not the cause of the residual antibacterial activity

Literature Information

  • ·Literature 1

    • Title

    • Identification and characterization of two novel clostridial bacteriocins, circularin A and closticin 574.

    • Reference

    • Appl Environ Microbiol. 2003 Mar;69(3):1589-97.

    • Author

    • Kemperman R, Kuipers A, Karsens H, Nauta A, Kuipers O, Kok J.
  • ·Literature 2

    • Title

    • Functional analysis of the gene cluster involved in production of the bacteriocin circularin A by Clostridium beijerinckii ATCC 25752.

    • Reference

    • Appl Environ Microbiol. 2003 Oct;69(10):5839-48.

    • Author

    • Kemperman R, Jonker M, Nauta A, Kuipers OP, Kok J.