General Information

    • DRAMP ID

    • DRAMP18260

    • Peptide Name

    • Bacteriocin 31 (Bacteriocin)

    • Source

    • Enterococcus faecalis Y1717

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • ATYYGNGLYCNKQKCWVDWNKASREIGKIIVNGWVQHGPWAPR

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(narrow)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell membrane

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • These bacteriocins are heat-stable, nonlanthionine, membrane-active peptides characterized by a Gly (22)

    • Helical Wheel Diagram

    • DRAMP18260 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

Physicochemical Information

    • Formula

    • C229H337N65O59S2

    • Absent Amino Acids

    • FM

    • Common Amino Acids

    • G

    • Mass

    • 5008.71

    • PI

    • 9.45

    • Basic Residues

    • 7

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +5

    • Boman Index

    • -6245

    • Hydrophobicity

    • -0.691

    • Aliphatic Index

    • 63.49

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 26595

    • Absorbance 280nm

    • 633.21

    • Polar Residues

    • 16

DRAMP18260

DRAMP18260 chydropathy plot

Comments Information

    • The deduced amino acid sequence of the mature protein of BacA showed a high degree of homology of the identical residues with the class II bacteriocin of lactic acid bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Cloning and genetic organization of the bacteriocin 31 determinant encoded on the Enterococcus faecalis pheromone-responsive conjugative plasmid pYI17.

    • Reference

    • J Bacteriol. 1996 Jun;178(12):3585-93.

    • Author

    • Tomita H, Fujimoto S, Tanimoto K, Ike Y.