General Information

    • DRAMP ID

    • DRAMP18265

    • Peptide Name

    • Enterocin RM6 (Bacteriocin)

    • Source

    • Enterococcus faecalis OSY-RM6

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • Not found

    • Sequence

    • MAKEFGIPAAVAGTVLNVVEAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

    • Sequence Length

    • 70

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Tandem mass spectrometry (MS/MS) analysis revealed that enterocin RM6 is a 70-residue cyclic peptide with a head-to-tail linkage between methionine and tryptophan residues.

    • Helical Wheel Diagram

    • DRAMP18265 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18265.

Physicochemical Information

    • Formula

    • C328H549N87O89S

    • Absent Amino Acids

    • CDHQ

    • Common Amino Acids

    • A

    • Mass

    • 7167.56

    • PI

    • 10.09

    • Basic Residues

    • 10

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 35

    • Net Charge

    • +6

    • Boman Index

    • -61

    • Hydrophobicity

    • 0.539

    • Aliphatic Index

    • 117.14

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 181.01

    • Polar Residues

    • 19

DRAMP18265

DRAMP18265 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Characterization and application of enterocin RM6, a bacteriocin from Enterococcus faecalis.

    • Reference

    • Biomed Res Int. 2013;2013:206917.

    • Author

    • Huang E, Zhang L, Chung YK, Zheng Z, Yousef AE.