General Information

    • DRAMP ID

    • DRAMP18266

    • Peptide Name

    • Bacteriocin T8(Bacteriocin)

    • Source

    • Enterococcus faecium (Streptococcus faecium)

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • bacA

    • Sequence

    • TYYGNGLYCNKEKCWVDWNQAKGEIGKIIVNGWVNH

    • Sequence Length

    • 36

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • The predicted mature BacA protein (44 amino acids) showed sequence homology with the membrane-active class IIa bacteriocins of lactic acid bacteria and showed 86% homology with bacteriocin 31 from E. faecalis YI717 and 98% homology with bacteriocin RC714.

    • Helical Wheel Diagram

    • DRAMP18266 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18266.

Physicochemical Information

    • Formula

    • C191H279N51O53S2

    • Absent Amino Acids

    • FMPRS

    • Common Amino Acids

    • GN

    • Mass

    • 4201.75

    • PI

    • 7.71

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 11

    • Net Charge

    • +2

    • Boman Index

    • -4307

    • Hydrophobicity

    • -0.636

    • Aliphatic Index

    • 70.28

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 21095

    • Absorbance 280nm

    • 602.71

    • Polar Residues

    • 16

DRAMP18266

DRAMP18266 chydropathy plot

Comments Information

    • Fuction

    • Bacteriocin T8 is active against E. faecalis isolated from patients diagnosed with vaginosis, against Lactobacillus sakei, and against a Propionibacterium sp. The peptide is heat stable (60 min at 100 degrees C) and remains active in phosphate buffer from pH 4.0 to 10.0.

Literature Information

  • ·Literature 1

    • Title

    • Bacteriocin T8, a novel class IIa sec-dependent bacteriocin produced by Enterococcus faecium T8, isolated from vaginal secretions of children infected with human immunodeficiency virus.

    • Reference

    • Appl Environ Microbiol. 2006 Jul;72(7):4761-6.

    • Author

    • De Kwaadsteniet M, Fraser T, Van Reenen CA, Dicks LM.
  • ·Literature 2

    • Title

    • Genetic analysis of bacteriocin 43 of vancomycin-resistant Enterococcus faecium.

    • Reference

    • Appl Environ Microbiol. 2006 Nov;72(11):6955-64.

    • Author

    • Todokoro D, Tomita H, Inoue T, Ike Y.