General Information

    • DRAMP ID

    • DRAMP18268

    • Peptide Name

    • Enterocin NKR-5-3C(Bacteriocin)

    • Source

    • Enterococcus faecium NKR-5-3

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • enkC

    • Sequence

    • ATYYGNGLYCNSKKCWVEWGITGGCLAQYAIGGWLGGAVPGKC

    • Sequence Length

    • 43

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Ent53C is a novel class IIa bacteriocin that contains a YGNVL motif sequence and two disul?de bridges.

    • Helical Wheel Diagram

    • DRAMP18268 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18268.

Physicochemical Information

    • Formula

    • C205H300N52O56S4

    • Absent Amino Acids

    • DFHMR

    • Common Amino Acids

    • G

    • Mass

    • 4517.19

    • PI

    • 8.47

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +2

    • Boman Index

    • 1005

    • Hydrophobicity

    • 0.107

    • Aliphatic Index

    • 68.14

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 22710

    • Absorbance 280nm

    • 540.71

    • Polar Residues

    • 23

DRAMP18268

DRAMP18268 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Gene cluster responsible for secretion of and immunity to multiple bacteriocins, the NKR-5-3 enterocins.

    • Reference

    • Appl Environ Microbiol. 2014 Nov;80(21):6647-55.

    • Author

    • Ishibashi N, Himeno K, Masuda Y, Perez RH, Iwatani S, Zendo T, Wilaipun P, Leelawatcharamas V, Nakayama J, Sonomoto K.