General Information

    • DRAMP ID

    • DRAMP18272

    • Peptide Name

    • Enterocin AS-48RJ (Bacteriocin)

    • Source

    • Enterococcus faecium RJ16

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • Not found

    • Sequence

    • MAKEFGIPAAVAGTVINVVVAGGWVTTIVSILTAVGSGGLSLLAAAGRESIKAYLKKEIKKKGKRAVIAW

    • Sequence Length

    • 70

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

    • Gram-positive, Gram-negative (broad-spectrum)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18272 helical wheel diagram

    • PDB ID

    • 1E68 resolved by NMR

    • Predicted Structure

    • There is no predicted structure for DRAMP18272.

Physicochemical Information

    • Formula

    • C328H551N87O87S

    • Absent Amino Acids

    • CDHQ

    • Common Amino Acids

    • A

    • Mass

    • 7137.57

    • PI

    • 10.29

    • Basic Residues

    • 10

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 36

    • Net Charge

    • +7

    • Boman Index

    • 1024

    • Hydrophobicity

    • 0.659

    • Aliphatic Index

    • 121.29

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 181.01

    • Polar Residues

    • 19

DRAMP18272

DRAMP18272 chydropathy plot

Comments Information

    • This is a natural variant of AS-48, where residue 20 is a Glu (Val in As-48RJ). It has the same activity spectrum as AS-48 .

Literature Information

  • ·Literature 1

    • Title

    • Enterocin AS-48RJ: a variant of enterocin AS-48 chromosomally encoded by Enterococcus faecium RJ16 isolated from food.

    • Reference

    • Syst Appl Microbiol. 2005 Jul;28(5):383-97.

    • Author

    • Abriouel H, Lucas R, Ben Omar N, Valdivia E, Maqueda M, Mart