General Information

    • DRAMP ID

    • DRAMP18277

    • Peptide Name

    • Halocin C8 (Bacteriocin)

    • Source

    • Halobacterium sp. (strain AS7092)

    • Family

    • Not found

    • Gene

    • proC8

    • Sequence

    • DIDITGCSACKYAAGQVCTIGCSAAGGFICGLLGITIPVAGLSCLGFVEIVCTVADEYSGCGDAVAKEACNRAGLC

    • Sequence Length

    • 76

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Cell wall

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • disulphide bridges

    • Structure Description

    • HalC8 contains 10 cysteines that could form disulphide bridges, leading to a little decrease in molecular weight.

    • Helical Wheel Diagram

    • DRAMP18277 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18277.

Physicochemical Information

    • Formula

    • C316H511N83O103S10

    • Absent Amino Acids

    • HMW

    • Common Amino Acids

    • GA

    • Mass

    • 7441.63

    • PI

    • 4.14

    • Basic Residues

    • 3

    • Acidic Residues

    • 7

    • Hydrophobic Residues

    • 31

    • Net Charge

    • -4

    • Boman Index

    • 1556

    • Hydrophobicity

    • 0.886

    • Aliphatic Index

    • 98.95

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3605

    • Absorbance 280nm

    • 48.07

    • Polar Residues

    • 33

DRAMP18277

DRAMP18277 chydropathy plot

Comments Information

    • quite stable, can be desalted, boiled, frozen, subjected to organic solvents, and stored in culture supernatant at 4

Literature Information

  • ·Literature 1

    • Title

    • Purification and biological characterization of halocin C8, a novel peptide antibiotic from Halobacterium strain AS7092.

    • Reference

    • Extremophiles. 2003 Oct;7(5):401-7.

    • Author

    • Li Y, Xiang H, Liu J, Zhou M, Tan H.
  • ·Literature 2

    • Title

    • A single gene directs both production and immunity of halocin C8 in a haloarchaeal strain AS7092.

    • Reference

    • Mol Microbiol. 2005 Jul;57(2):537-49.

    • Author

    • Sun C, Li Y, Mei S, Lu Q, Zhou L, Xiang H.