General Information

    • DRAMP ID

    • DRAMP18280

    • Peptide Name

    • Plantaricin 163 (Bacteriocin)

    • Source

    • Lactobacillus plantarum 163

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • VFHAYSARGNYYGNCPANWPSCRNNYKSAGGK

    • Sequence Length

    • 32

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • broad-spectrum

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18280 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18280.

Physicochemical Information

    • Formula

    • C156H222N48O45S2

    • Absent Amino Acids

    • DEILMQT

    • Common Amino Acids

    • N

    • Mass

    • 3553.89

    • PI

    • 9.51

    • Basic Residues

    • 5

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 7

    • Net Charge

    • +5

    • Boman Index

    • -6665

    • Hydrophobicity

    • -0.988

    • Aliphatic Index

    • 21.56

    • Half Life

      • Mammalian:100 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 11585

    • Absorbance 280nm

    • 373.71

    • Polar Residues

    • 18

DRAMP18280

DRAMP18280 chydropathy plot

Comments Information

    • Plantaricin 163 was highly thermostable (20 min, 121 degrees C), active in the presence of acidic pH (3-5), sensitive to protease, and exhibited broad-spectrum antimicrobial activity against LAB and other tested Gram-positive and Gram-negative bacteria.

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of plantaricin 163, a novel bacteriocin produced by Lactobacillus plantarum 163 isolated from traditional Chinese fermented vegetables.

    • Reference

    • J Agric Food Chem. 2013 Nov 27;61(47):11676-82.

    • Author

    • Hu M, Zhao H, Zhang C, Yu J, Lu Z.