General Information

    • DRAMP ID

    • DRAMP18281

    • Peptide Name

    • Plantaricin KL-1Y (Bacteriocin)

    • Source

    • Lactobacillus plantarum KL-1

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • GRADYNFGYGLGRGTRKFFNGIGRWVRKTF

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

    • Gram-positive, Gram-negative (broad-spectrum)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18281 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18281.

Physicochemical Information

    • Formula

    • C161H238N50O39

    • Absent Amino Acids

    • CEHMPQS

    • Common Amino Acids

    • G

    • Mass

    • 3497.97

    • PI

    • 11.47

    • Basic Residues

    • 7

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +6

    • Boman Index

    • -7660

    • Hydrophobicity

    • -0.767

    • Aliphatic Index

    • 39

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 8480

    • Absorbance 280nm

    • 292.41

    • Polar Residues

    • 13

DRAMP18281

DRAMP18281 chydropathy plot

Comments Information

    • It showed synergistic effects with KL-1X and KL-1Z, two additional peptides whose sequences have not been established.

Literature Information

  • ·Literature 1

    • Title

    • Purification and characterization of a novel plantaricin, KL-1Y, from Lactobacillus plantarum KL-1.

    • Reference

    • World J Microbiol Biotechnol. 2015 Jun;31(6):983-94.

    • Author

    • Rumjuankiat K, Perez RH, Pilasombut K, Keawsompong S, Zendo T, Sonomoto K, Nitisinprasert S.