General Information

    • DRAMP ID

    • DRAMP18284

    • Peptide Name

    • Reutericin 6 (Bacteriocin)

    • Source

    • Lactobacillus reuteri LA6

    • Family

    • Belongs to the class IIc bacteriocin

    • Gene

    • Not found

    • Sequence

    • IYWIADQFGIHLATGTARKLLDAMASGASLGTAFAAILGVTLPAWALAAAGALGATAA

    • Sequence Length

    • 58

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(certain)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • No specific N-terminal

    • C-terminal Modification

    • No specific C-terminal

    • Nonterminal Modifications and Unusual Amino Acids

    • None

    • Stereochemistry

    • L

    • Structure

    • Alpha helix

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18284 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18284.

Physicochemical Information

    • Formula

    • C261H411N67O72S

    • Absent Amino Acids

    • CEN

    • Common Amino Acids

    • A

    • Mass

    • 5671.6

    • PI

    • 6.75

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 35

    • Net Charge

    • +1

    • Boman Index

    • 4731

    • Hydrophobicity

    • 0.997

    • Aliphatic Index

    • 116.72

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 12490

    • Absorbance 280nm

    • 219.12

    • Polar Residues

    • 15

DRAMP18284

DRAMP18284 chydropathy plot

Comments Information

    • L.reuteri LA6 has the structural gene for gassericin A with no variations among those primers. These results indicate that a bacteriocin of the same structure has been produced by different lactobacilli species isolated from the same infant.

Literature Information

  • ·Literature 1

    • Title

    • Reutericin 6, a new bacteriocin produced by Lactobacillus reuteri LA 6.

    • Reference

    • Letters in Applied Microbiology. 1991 Dec;13(6):281

    • Author

    • T. Toba, S.K. Samant, E. Yoshioka and T. Itoh