General Information

    • DRAMP ID

    • DRAMP18285

    • Peptide Name

    • Bacteriocin LS2 (Bacteriocin)

    • Source

    • Lactobacillus salivarius BGHO1

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • bacls2

    • Sequence

    • TNWKKIGKCYAGTLGSAVLGFGAMGPVGYWAGAGVGYASFC

    • Sequence Length

    • 41

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18285 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18285.

Physicochemical Information

    • Formula

    • C190H279N47O50S3

    • Absent Amino Acids

    • DEHQR

    • Common Amino Acids

    • G

    • Mass

    • 4117.77

    • PI

    • 9.18

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +3

    • Boman Index

    • 2702

    • Hydrophobicity

    • 0.451

    • Aliphatic Index

    • 64.39

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15595

    • Absorbance 280nm

    • 389.88

    • Polar Residues

    • 20

DRAMP18285

DRAMP18285 chydropathy plot

Comments Information

    • Note that the strain Lactobacillus salivarius BGHO1 exhibits a wide antimicrobial spectrum against S. flexneri, S. sonnei, S. dysenteriae, S. boydii, Y. enterocolitica, S. enteritidis, L. innocua, S. aureus, E. faecalis, M. flavus, S. pneumoniae and S. mutans. However, this broad spectrum could result from synergistic effect of its bacteriocins and the lactic acid which, in addition to the general antimicrobial effects exhibited by lowering the pH, can permeabilise the outer membrane of Gram-negative bacteria and make them more vulnerable to the effects of bacteriocins.

Literature Information

  • ·Literature 1

    • Title

    • Purification and genetic characterisation of the novel bacteriocin LS2 produced by the human oral strain Lactobacillus salivarius BGHO1.

    • Reference

    • Int J Antimicrob Agents. 2012 Aug;40(2):127-34.

    • Author

    • Busarcevic M, Dalgalarrondo M.