General Information

    • DRAMP ID

    • DRAMP18286

    • Peptide Name

    • Blp1a(Bacteriocin)

    • Source

    • Lactobacillus salivarius BGHO1

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • ECELAKVDGGYTPKNCAMAVGGGMLSGAIRGGMSGTVFGVGTGNLAGAFAGAHIGLVAGGLACIGGYLGSH

    • Sequence Length

    • 71

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18286 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18286.

Physicochemical Information

    • Formula

    • C287H458N82O88S6

    • Absent Amino Acids

    • QW

    • Common Amino Acids

    • G

    • Mass

    • 6657.65

    • PI

    • 6.98

    • Basic Residues

    • 5

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 26

    • Net Charge

    • +2

    • Boman Index

    • 2908

    • Hydrophobicity

    • 0.58

    • Aliphatic Index

    • 83.94

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3105

    • Absorbance 280nm

    • 44.36

    • Polar Residues

    • 33

DRAMP18286

DRAMP18286 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Purification and genetic characterisation of the novel bacteriocin LS2 produced by the human oral strain Lactobacillus salivarius BGHO1.

    • Reference

    • Int J Antimicrob Agents. 2012 Aug;40(2):127-34.

    • Author

    • Busarcevic M, Dalgalarrondo M.