• DRAMP ID

    • DRAMP18287
    • Peptide Name

    • Blp1b(Bacteriocin)
    • Source

    • Lactobacillus salivarius BGHO1
    • Family

    • Belongs to the class IIb bacteriocin
    • Gene

    • Not found
    • Sequence

    • MSYEKLNNEELSKILGGNGINWGAVAGSCASGAVIGAAFGNPLTGCVANSAFSFSWQAFKNRPRPKKIA
    • Sequence Length

    • 69
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+
    • Target Organism

    • Gram-positive
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18287 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18287.
    • Formula

    • C319H496N90O93S3
    • Absent Amino Acids

    • DH
    • Common Amino Acids

    • AG
    • Mass

    • 7176.17
    • PI

    • 9.51
    • Basic Residues

    • 7
    • Acidic Residues

    • 3
    • Hydrophobic Residues

    • 27
    • Net Charge

    • +4
    • Boman Index

    • -5702
    • Hydrophobicity

    • -0.042
    • Aliphatic Index

    • 72.32
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 12615
    • Absorbance 280nm

    • 185.51
    • Polar Residues

    • 27

DRAMP18287

DRAMP18287 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • Purification and genetic characterisation of the novel bacteriocin LS2 produced by the human oral strain Lactobacillus salivarius BGHO1.
    • Reference

    • Int J Antimicrob Agents. 2012 Aug;40(2):127-34.
    • Author

    • Busarcevic M, Dalgalarrondo M.