General Information

    • DRAMP ID

    • DRAMP18288

    • Peptide Name

    • Sln1 (Bacteriocin)

    • Source

    • Lactobacillus salivarius DPC6005

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • Not found

    • Sequence

    • KRGPNCVGNFLGGLFAGAAAGVPLGPAGIVGGANLGMVGGALTCL

    • Sequence Length

    • 45

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18288 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18288.

Physicochemical Information

    • Formula

    • C181H296N52O50S3

    • Absent Amino Acids

    • DEHQSWY

    • Common Amino Acids

    • G

    • Mass

    • 4096.84

    • PI

    • 8.96

    • Basic Residues

    • 2

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 20

    • Net Charge

    • +2

    • Boman Index

    • 4340

    • Hydrophobicity

    • 0.88

    • Aliphatic Index

    • 102

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 125

    • Absorbance 280nm

    • 2.84

    • Polar Residues

    • 19

DRAMP18288

DRAMP18288 chydropathy plot

Comments Information

    • Shown is the sequence for chain a, which is identical at the amino acid level to the chain a of ABP-118. The peptide sequence for chain b is also similar to chain b of ABP-118 with only two changes

    • T43 to Ala and Arg46 to His.

Literature Information

  • ·Literature 1

    • Title

    • Salivaricin P, one of a family of two-component antilisterial bacteriocins produced by intestinal isolates of Lactobacillus salivarius.

    • Reference

    • Appl Environ Microbiol. 2007 Jun;73(11):3719-23.

    • Author

    • Barrett E, Hayes M, O'Connor P, Gardiner G, Fitzgerald GF, Stanton C, Ross RP, Hill C.