General Information

    • DRAMP ID

    • DRAMP18290

    • Peptide Name

    • Garvicin A (Bacteriocin)

    • Source

    • Lactococcus garvieae 21881

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • Not found

    • Sequence

    • IGGALGNALNGLGTWANMMNGGGFVNQWQVYANKGKINQYRPY

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(certain)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18290 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18290.

Physicochemical Information

    • Formula

    • C208H312N60O58S2

    • Absent Amino Acids

    • CDEHS

    • Common Amino Acids

    • G

    • Mass

    • 4645.25

    • PI

    • 9.82

    • Basic Residues

    • 3

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -3139

    • Hydrophobicity

    • -0.379

    • Aliphatic Index

    • 68.14

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15470

    • Absorbance 280nm

    • 368.33

    • Polar Residues

    • 20

DRAMP18290

DRAMP18290 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Garvicin A, a novel class IId bacteriocin from Lactococcus garvieae that inhibits septum formation in L. garvieae strains.

    • Reference

    • Appl Environ Microbiol. 2013 Jul;79(14):4336-46.

    • Author

    • Maldonado-Barrag