General Information

    • DRAMP ID

    • DRAMP18291

    • Peptide Name

    • Garviecin LG34(Bacteriocin)

    • Source

    • Lactococcus garvieae LG34

    • Family

    • Belongs to the class IIa bacteriocin

    • Gene

    • Not found

    • Sequence

    • LAMVKYYGNGVSCNWRKHSCKKGLSVDWVYFGLLHNLGALRWYQHR

    • Sequence Length

    • 46

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-

    • Target Organism

    • Gram-positive, Gram-negative

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18291 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18291.

Physicochemical Information

    • Formula

    • C251H374N72O60S3

    • Absent Amino Acids

    • EIPT

    • Common Amino Acids

    • L

    • Mass

    • 5456.36

    • PI

    • 9.83

    • Basic Residues

    • 10

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 16

    • Net Charge

    • +9

    • Boman Index

    • -5700

    • Hydrophobicity

    • -0.339

    • Aliphatic Index

    • 80.43

    • Half Life

      • Mammalian:5.5 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 22585

    • Absorbance 280nm

    • 501.89

    • Polar Residues

    • 17

DRAMP18291

DRAMP18291 chydropathy plot

Comments Information

    • Garviecin LG34 showed resistance to heat and low pH, and was sensitive to proteolytic enzymes but not to lipase and amylase.

Literature Information

  • ·Literature 1

    • Title

    • Garviecin LG34, a novel bacteriocin produced by Lactococcus garvieae isolated from traditional Chinese fermented cucumber.

    • Reference

    • Food Control. 2015 Apr;50:896-900.

    • Author

    • Gao YR,Li DP,Liu S,Zhang LY.