General Information

    • DRAMP ID

    • DRAMP18292

    • Peptide Name

    • LsbA(Bacteriocin)

    • Source

    • Lactococcus lactis

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • lsbA

    • Sequence

    • FKKKKRNIGTFVFFAIALFCTVMFAYLLLTNQYVPIDYNVPRYA

    • Sequence Length

    • 44

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive(narrow)

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18292 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18292.

Physicochemical Information

    • Formula

    • C253H380N58O58S2

    • Absent Amino Acids

    • EHSW

    • Common Amino Acids

    • F

    • Mass

    • 5226.27

    • PI

    • 9.81

    • Basic Residues

    • 6

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +5

    • Boman Index

    • -1420

    • Hydrophobicity

    • 0.475

    • Aliphatic Index

    • 97.5

    • Half Life

      • Mammalian:1.1 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 5960

    • Absorbance 280nm

    • 138.6

    • Polar Residues

    • 12

DRAMP18292

DRAMP18292 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Novel mechanism of bacteriocin secretion and immunity carried out by lactococcal multidrug resistance proteins.

    • Reference

    • J Biol Chem. 2003 Sep 5;278(36):34291-8.

    • Author

    • Gajic O, Buist G, Kojic M, Topisirovic L, Kuipers OP, Kok J.