• DRAMP ID

    • DRAMP18308
    • Peptide Name

    • Planosporicin(Bacteriocin)
    • Source

    • Planomonospora alba
    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)
    • Gene

    • pspA
    • Sequence

    • MGISSPALPQNTADLFQLDLEIGVEQSLASPAITSVSWCTPGCTSEGGGSGCSHCC
    • Sequence Length

    • 56
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antibacterial
    • Target Organism

    • broad-spectrum
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Not found
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18308 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18308.
    • Formula

    • C235H371N63O84S6
    • Absent Amino Acids

    • KRY
    • Common Amino Acids

    • S
    • Mass

    • 5615.26
    • PI

    • 3.83
    • Basic Residues

    • 1
    • Acidic Residues

    • 5
    • Hydrophobic Residues

    • 16
    • Net Charge

    • -4
    • Boman Index

    • -3135
    • Hydrophobicity

    • 0.188
    • Aliphatic Index

    • 73.21
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 5750
    • Absorbance 280nm

    • 104.55
    • Polar Residues

    • 26

DRAMP18308

DRAMP18308 chydropathy plot
    • Comment

    • No comments found on DRAMP database
  • ·Literature 1
    • Title

    • A novel lantibiotic acting on bacterial cell wall synthesis produced by the uncommon actinomycete Planomonospora sp.
    • Reference

    • Biochemistry. 2007 May 22;46(20):5884-95.
    • Author

    • Castiglione F, Cavaletti L, Losi D, Lazzarini A, Carrano L, Feroggio M, Ciciliato I, Corti E, Candiani G, Marinelli F, Selva E.