General Information

    • DRAMP ID

    • DRAMP18312

    • Peptide Name

    • Propionicin PLG-1(Bacteriocin)

    • Source

    • Propionibacterium thoeniiP127

    • Family

    • Not found

    • Gene

    • plg-1

    • Sequence

    • MTDANVDARRARAPHGISGAIAGVVAGCAATIEIGCVEGAIAGIGPSGIASMIAALWTCRSKYRRFSSGSGYVMLLSWSAEFVFGYFIGCRCGFLLSQK

    • Sequence Length

    • 99

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+, Anti-Gram-, Antifungal

    • Target Organism

    • Gram-positive, Gram-negative

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18312 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18312.

Physicochemical Information

    • Formula

    • C455H716N128O128S8

    • Absent Amino Acids

    • Common Amino Acids

    • AG

    • Mass

    • 10283.95

    • PI

    • 9.01

    • Basic Residues

    • 10

    • Acidic Residues

    • 5

    • Hydrophobic Residues

    • 42

    • Net Charge

    • +5

    • Boman Index

    • -4594

    • Hydrophobicity

    • 0.528

    • Aliphatic Index

    • 87.88

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 15720

    • Absorbance 280nm

    • 160.41

    • Polar Residues

    • 36

DRAMP18312

DRAMP18312 chydropathy plot

Comments Information

    • Propionicin PLG-1 is active against a variety of microorganisms such as propionibacteria, as well as many other gram-positive and gram-negative bacteria and even fungi.Propionicin PLG-1 is stable after long-term storage in a dry or frozen state and rapidly kills sensitive cells upon exposure in culture medium or skim milk.

Literature Information

  • ·Literature 1

    • Title

    • Biochemical and genetic characterization of propionicin T1, a new bacteriocin from Propionibacterium thoenii.

    • Reference

    • Appl Environ Microbiol. 2000 Oct;66(10):4230-6.

    • Author

    • Faye T, Langsrud T, Nes IF, Holo H.