General Information

    • DRAMP ID

    • DRAMP18326

    • Peptide Name

    • Bovicin 255(Bacteriocin)

    • Source

    • Streptococcus bovis

    • Family

    • Belongs to the class II bacteriocin

    • Gene

    • Not found

    • Sequence

    • NGEWGYVVTKGAFQATTDVIANGWVSSLGGGYFGKP

    • Sequence Length

    • 36

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • The prepeptide shares homology with the nonlantibiotic bacteriocins lactococcin A of Lactobacillus lactis (identities, 29%; positives, 48%) and thermophilin A of Streptococcus thermophilus (identities, 35%; positives, 42%). However, the homology with thermophilin A seems to reside primarily in the leader sequence (identities, 65%; positives, 73%), whereas homology with lactococcin A is distributed along the length of the prepeptide.

    • Helical Wheel Diagram

    • DRAMP18326 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18326.

Physicochemical Information

    • Formula

    • C172H249N43O51

    • Absent Amino Acids

    • CHMR

    • Common Amino Acids

    • G

    • Mass

    • 3735.13

    • PI

    • 6.07

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 13

    • Net Charge

    • 0

    • Boman Index

    • -1067

    • Hydrophobicity

    • -0.058

    • Aliphatic Index

    • 62.22

    • Half Life

      • Mammalian:1.4 hour
      • Yeast:3 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 13980

    • Absorbance 280nm

    • 399.43

    • Polar Residues

    • 17

DRAMP18326

DRAMP18326 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Identification of bacteriocin-like inhibitors from rumen Streptococcus spp. and isolation and characterization of bovicin 255.

    • Reference

    • Appl Environ Microbiol. 2001 Feb;67(2):569-74.

    • Author

    • Whitford MF, McPherson MA, Forster RJ, Teather RM.