General Information

    • DRAMP ID

    • DRAMP18327

    • Peptide Name

    • Sil(Bacteriocin)

    • Source

    • Streptococcus iniae SF1

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • Not found

    • Sequence

    • ESISVAGGTWNYGYGVGQAYSHYKHDYNNHGAKVVNSNNGVKDYKNAGPGVWAKASIGTVWDPATFYYNPTGFYSN

    • Sequence Length

    • 76

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18327 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18327.

Physicochemical Information

    • Formula

    • C377H528N100O114

    • Absent Amino Acids

    • CLMR

    • Common Amino Acids

    • G

    • Mass

    • 8284.94

    • PI

    • 8.24

    • Basic Residues

    • 8

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 21

    • Net Charge

    • +4

    • Boman Index

    • -9786

    • Hydrophobicity

    • -0.693

    • Aliphatic Index

    • 46.18

    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 29910

    • Absorbance 280nm

    • 398.8

    • Polar Residues

    • 39

DRAMP18327

DRAMP18327 chydropathy plot

Comments Information

    • SIL is secreted by S. iniae into the extracellular milieu. Although it displayed antibacterial activity against B. subtilis, SIL showed no effect on 22 other Gram+ and Gram- bacteria tested. It can attach to the B. subtilis surface without killing (bacteriostatic). Activity is lost by heating at 50oC (heat-sensitive). SIL may serve as a virulent factor for infection. This dual role as antimicrobial and immune modulator suggests that a good understanding of the functions of an AMP is essential.

Literature Information

  • ·Literature 1

    • Title

    • Sil: a Streptococcus iniae bacteriocin with dual role as an antimicrobial and an immunomodulator that inhibits innate immune response and promotes S. iniae infection.

    • Reference

    • PLoS One. 2014 Apr 29;9(4):e96222.

    • Author

    • Li MF, Zhang BC, Li J, Sun L.