General Information

    • DRAMP ID

    • DRAMP18328

    • Peptide Name

    • Pneumococin M(Bacteriocin)

    • Source

    • Streptococcus pneumoniae?TIGR4

    • Family

    • Belongs to the class IIb bacteriocin

    • Gene

    • blpM

    • Sequence

    • KNNWQTNVLEGGGAAFGGWGLGTAICAASGVGAPFMGACGYIGAKFGVDLWAGVTGATGGF

    • Sequence Length

    • 61

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18328 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18328.

Physicochemical Information

    • Formula

    • C265H390N70O76S3

    • Absent Amino Acids

    • HR

    • Common Amino Acids

    • G

    • Mass

    • 5868.61

    • PI

    • 6.05

    • Basic Residues

    • 2

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 26

    • Net Charge

    • 0

    • Boman Index

    • 3275

    • Hydrophobicity

    • 0.467

    • Aliphatic Index

    • 67.38

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 18115

    • Absorbance 280nm

    • 301.92

    • Polar Residues

    • 28

DRAMP18328

DRAMP18328 chydropathy plot

Comments Information

    • Comparison of the TIGR4 BlpM and -N amino acid sequences demonstrated that only ?ve amino acid differences were suf?cient to target the heterologous strain.

Literature Information

  • ·Literature 1

    • Title

    • The blp bacteriocins of Streptococcus pneumoniae mediate intraspecies competition both in vitro and in vivo.

    • Reference

    • Infect Immun. 2007 Jan;75(1):443-51.

    • Author

    • Dawid S, Roche AM, Weiser JN.