General Information

    • DRAMP ID

    • DRAMP18330

    • Peptide Name

    • streptolysin S(Bacteriocin)

    • Source

    • Streptococcus pyogenes MGAS 8232

    • Family

    • Belongs to the class I bacteriocin

    • Gene

    • sagA

    • Sequence

    • CCCCCTTCCFSIATGSGNSQGGSGSYTPGK

    • Sequence Length

    • 30

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Unknown

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18330 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18330.

Physicochemical Information

    • Formula

    • C111H175N33O43S7

    • Absent Amino Acids

    • DEHLMRVW

    • Common Amino Acids

    • C

    • Mass

    • 2884.23

    • PI

    • 7.73

    • Basic Residues

    • 1

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 3

    • Net Charge

    • +1

    • Boman Index

    • -2084

    • Hydrophobicity

    • 0.12

    • Aliphatic Index

    • 16.33

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 64.31

    • Polar Residues

    • 24

DRAMP18330

DRAMP18330 chydropathy plot

Comments Information

    • Streptolysin S (SLS) is a bacteriocin-like haemolytic and cytotoxic virulence factor that plays a key role in the virulence of Group A Streptococcus(GAS). The peptide contributes to the cytotoxicity, inflammatory activation and polymorphonuclear neutrophil (PMN) resistance of GAS, thereby playing a role in necrosis and systemic spread. It is also responsible for the associated characteristic beta-haemolytic activity.

Literature Information

  • ·Literature 1

    • Title

    • Listeriolysin S, a novel peptide haemolysin associated with a subset of lineage I Listeria monocytogenes.

    • Reference

    • PLoS Pathog. 2008 Sep 12;4(9):e1000144.

    • Author

    • Cotter PD, Draper LA, Lawton EM, Daly KM, Groeger DS, Casey PG, Ross RP, Hill C.