General Information

    • DRAMP ID

    • DRAMP18332

    • Peptide Name

    • BHT-Aa(Bacteriocin)

    • Source

    • Streptococcus rattus BHT

    • Family

    • Belongs to the lantibiotics family (Class I bacteriocin)

    • Gene

    • bht-a

    • Sequence

    • GTTVVNSTFSIVLGNKGYICTVTVECMRNCQ

    • Sequence Length

    • 31

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • tryptophan rich

    • Structure Description

    • A variant of Smb, as evidenced by the fact that the two operons share 95% identity.

    • Helical Wheel Diagram

    • DRAMP18332 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18332.

Physicochemical Information

    • Formula

    • C141H233N39O46S4

    • Absent Amino Acids

    • ADHPW

    • Common Amino Acids

    • TV

    • Mass

    • 3338.87

    • PI

    • 7.95

    • Basic Residues

    • 2

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 9

    • Net Charge

    • +1

    • Boman Index

    • -2558

    • Hydrophobicity

    • 0.403

    • Aliphatic Index

    • 84.52

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1615

    • Absorbance 280nm

    • 53.83

    • Polar Residues

    • 17

DRAMP18332

DRAMP18332 chydropathy plot

Comments Information

    • The amino acid sequence of another chain (BhtA2) is STPACAIGVVGITVAVTGISTACTSRCINK, which is identical to SmbA.

Literature Information

  • ·Literature 1

    • Title

    • Streptococcus rattus strain BHT produces both a class I two-component lantibiotic and a class II bacteriocin.

    • Reference

    • FEMS Microbiol Lett. 2005 Nov 15;252(2):235-41.

    • Author

    • Hyink O, Balakrishnan M, Tagg JR.
  • ·Literature 2

    • Title

    • Two-peptide lantibiotics: a medical perspective.

    • Reference

    • Mini Rev Med Chem. 2007 Dec;7(12):1236-47.

    • Author

    • Lawton EM, Ross RP, Hill C, Cotter PD.