General Information

    • DRAMP ID

    • DRAMP18334

    • Peptide Name

    • BHT-B (Bacteriocin)

    • Source

    • Streptococcus rattus BHT

    • Family

    • Belongs to the class IId bacteriocin

    • Gene

    • bht-b

    • Sequence

    • MWGRILAFVAKYGTKAVQWAWKNKWFLLSLGEAVFDYIRSIWGG

    • Sequence Length

    • 44

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram+

    • Target Organism

    • Gram-positive

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • BHT-B is a non-modi?ed 5195 Da peptide with some similarity to the tryptophan-rich Staphylococcus aureus bacteriocin, aureocin A53.

    • Helical Wheel Diagram

    • DRAMP18334 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18334.

Physicochemical Information

    • Formula

    • C251H365N61O56S

    • Absent Amino Acids

    • CHP

    • Common Amino Acids

    • AGW

    • Mass

    • 5165.09

    • PI

    • 9.99

    • Basic Residues

    • 6

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 23

    • Net Charge

    • +4

    • Boman Index

    • -615

    • Hydrophobicity

    • 0.241

    • Aliphatic Index

    • 93.18

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 30480

    • Absorbance 280nm

    • 708.84

    • Polar Residues

    • 11

DRAMP18334

DRAMP18334 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Streptococcus rattus strain BHT produces both a class I two-component lantibiotic and a class II bacteriocin.

    • Reference

    • FEMS Microbiol Lett. 2005 Nov 15;252(2):235-41.

    • Author

    • Hyink O, Balakrishnan M, Tagg JR.