General Information

    • DRAMP ID

    • DRAMP18352

    • Peptide Name

    • Durancin GL (bacteriocin)

    • Source

    • Enterococcus durans

    • Family

    • Belongs to the class IIa bacteriocin.

    • Gene

    • Not found

    • Sequence

    • ATYYGNGVYCNKQECWVDWNKASKEIGKIIVNGWVQHGPWAPR

    • Sequence Length

    • 43

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18352 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18352.

Physicochemical Information

    • Formula

    • C227H330N62O61S2

    • Absent Amino Acids

    • FLM

    • Common Amino Acids

    • G

    • Mass

    • 4967.62

    • PI

    • 8.74

    • Basic Residues

    • 6

    • Acidic Residues

    • 3

    • Hydrophobic Residues

    • 14

    • Net Charge

    • +3

    • Boman Index

    • -5522

    • Hydrophobicity

    • -0.658

    • Aliphatic Index

    • 61.16

    • Half Life

      • Mammalian:4.4 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 26595

    • Absorbance 280nm

    • 633.21

    • Polar Residues

    • 16

DRAMP18352

DRAMP18352 chydropathy plot

Comments Information

    • Fuction

    • Plasmid-encoded bacteriocin is active against the indicator strain E. durans 41D-S1, L. monocytogenes strains, including nisin-resistant L. monocytogenes NR30.

Literature Information

  • ·Literature 1

    • Title

    • Molecular analysis of the bacteriocin-encoding plasmid pDGL1 from Enterococcus durans and genetic characterization of the durancin GL locus.

    • Reference

    • Microbiology. 2012 Jun;158(Pt 6):1523-32.

    • Author

    • Du L, Somkuti GA, Renye JA Jr.