General Information

    • DRAMP ID

    • DRAMP18356

    • Peptide Name

    • BacSP222 (bacteriocin)

    • Source

    • isolated from dog skin lesions, Staphylococcus pseudintermedius strain 222

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • MAGLLRFLLSKGRALYNWAKSHVGKVWEWLKSGATYEQIKEWIENALGWR

    • Sequence Length

    • 50

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antibacterial, Mammalian cells, Antimicrobial

    • Target Organism

    • Active against B. subtilis ATCC 6633 (MIC 0.16 uM), L. lactis subsp. lactis LOCK 0871 strain 239 (MIC 0.89 uM), M. luteus ATCC 4698 (MIC 0.11 uM), S. aureus DSM 26258 (CH91), S. aureus MRSA USA300 strain FPR3757, S. aureus KB/8658, S. aureus ATCC 25923 (MIC 0.89-1.3 uM), S. epidermidis ATCC 35547 (MIC 4.4 uM), S. intermedius ATCC 29663, S. intermedius R-2725 (MIC 1.2-2 uM), S. pseudintermedius 222, S. pseudintermedius LMG 22219 (MIC 2.1 and 0.16 uM), S. saprophyticus ATCC 15305 (MIC 0.93 uM), S. pyogenes PCM 465 (MIC 7.8 uM), S. sanguinis PCM 2335 (MIC 3.5 uM), and C. albicans ATCC 10231 (MIC 100 uM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18356 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18356.

Physicochemical Information

    • Formula

    • C276H418N74O68S

    • Absent Amino Acids

    • CDP

    • Common Amino Acids

    • L

    • Mass

    • 5892.87

    • PI

    • 9.87

    • Basic Residues

    • 9

    • Acidic Residues

    • 4

    • Hydrophobic Residues

    • 22

    • Net Charge

    • +5

    • Boman Index

    • -5319

    • Hydrophobicity

    • -0.304

    • Aliphatic Index

    • 91.8

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 30480

    • Absorbance 280nm

    • 622.04

    • Polar Residues

    • 13

DRAMP18356

DRAMP18356 chydropathy plot

Comments Information

    • Fuction

    • No acitivtiy against two Gram-negative bacteria tested (see the article). N-terminal formylation is not needed for antibacterial effects since a synthetic peptide without this modification works better.

Literature Information

  • ·Literature 1

    • Title

    • A peptide factor secreted by Staphylococcus pseudintermedius exhibits properties of both bacteriocins and virulence factors

    • Reference

    • Sci Rep. 2015 Sep 28;5:14569

    • Author

    • Wladyka B, Piejko M, Bzowska M, Pieta P, Krzysik M, Mazurek ?, Guevara-Lora I, Bukowski M, Sabat AJ, Friedrich AW, Bonar E, Mi?dzobrodzki J, Dubin A, Mak P.2015