• DRAMP ID

    • DRAMP18365
    • Peptide Name

    • Thusin (ThsA1, ThsA2; a two-chain lantibiotic, type 2, class 1 bacteriocins)
    • Source

    • Bacillus thuringiensis strain BGSC 4BT1, serovar rongseni
    • Family

    • Belongs to the lantibiotic family (class I bacteriocins)
    • Gene

    • N/A
    • Sequence

    • INTWNTTATSTSIIISETFGNKGKVCTYTVECVNNCRG
    • Sequence Length

    • 38
    • Evidence code

    • Biological Activity

    • Antibacterial, Antimicrobial
    • Target Organism

      • Active against S. pneumoniae ATCC 49619, B. cereus ATCC 14579, B. thuringiensis BMB171, B. pumilus SCG I , B. subtilis Bsn5, L. monocytogenes LM201 (MIC 6.25 uM), L. monocytogenes LM605, S. aureus ATCC 43300, S. sciuri Bom1, B. amyloliquefaciens X1 (MIC 12.5 uM), S. aureus CMCC 26003, MRSA (MIC 25 uM), and E. faecalis ATCC 29212 (MIC 50 uM).
    • Hemolytic Activity

      • N/A
    • Cytotoxicity

    • Binding Target

    • N/A
    • Linear/Cyclic/Branched

    • N-terminal modification

    • C-terminal modification

    • Other modifications

    • Stereochemistry

    • Structure

    • N/A
    • Structure Description

    • N/A
    • DRAMP18365 helical wheel diagram
    • Formula

    • C175H279N49O59S3
    • Absent Amino Acids

    • DHLMPQ
    • Common Amino Acids

    • T
    • Mass

    • 478758
    • PI

    • 8.04
    • Basic Residues

    • 3
    • Acidic Residues

    • 2
    • Hydrophobic Residues

    • 10
    • Boman Index

    • -5816
    • Hydrophobicity

    • -14.1
    • Aliphatic Index

    • 64.87
    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 7115
    • Absorbance 280nm

    • 187.24
    • Polar Residues

    • 23

DRAMP18365

DRAMP18365 chydropathy plot
    • No comments found on DRAMP database

  • Literature 1
    • Reference

    • Front Microbiol. 2016 Jul 19;7:1115.
    • Author

    • Xin B, Zheng J, Liu H, Li J, Ruan L, Peng D, Sajid M, Sun M
    • Title

    • Thusin, a Novel Two-Component Lantibiotic with Potent Antimicrobial Activity against Several Gram-Positive Pathogens.