General Information

    • DRAMP ID

    • DRAMP18365

    • Peptide Name

    • Thusin (ThsA1, ThsA2; a two-chain lantibiotic, type 2, class 1 bacteriocins)

    • Source

    • Bacillus thuringiensis strain BGSC 4BT1, serovar rongseni

    • Family

    • Belongs to the lantibiotic family (class I bacteriocins)

    • Gene

    • Not found

    • Sequence

    • INTWNTTATSTSIIISETFGNKGKVCTYTVECVNNCRG

    • Sequence Length

    • 38

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against S. pneumoniae ATCC 49619, B. cereus ATCC 14579, B. thuringiensis BMB171, B. pumilus SCG I , B. subtilis Bsn5, L. monocytogenes LM201 (MIC 6.25 uM), L. monocytogenes LM605, S. aureus ATCC 43300, S. sciuri Bom1, B. amyloliquefaciens X1 (MIC 12.5 uM), S. aureus CMCC 26003, MRSA (MIC 25 uM), and E. faecalis ATCC 29212 (MIC 50 uM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18365 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18365.

Physicochemical Information

    • Formula

    • C175H279N49O59S3

    • Absent Amino Acids

    • DHLMPQ

    • Common Amino Acids

    • T

    • Mass

    • 4127.63

    • PI

    • 7.94

    • Basic Residues

    • 3

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 10

    • Net Charge

    • +1

    • Boman Index

    • -5816

    • Hydrophobicity

    • -0.141

    • Aliphatic Index

    • 64.87

    • Half Life

      • Mammalian:20 hour
      • Yeast:30 min
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 7115

    • Absorbance 280nm

    • 187.24

    • Polar Residues

    • 23

DRAMP18365

DRAMP18365 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Thusin, a Novel Two-Component Lantibiotic with Potent Antimicrobial Activity against Several Gram-Positive Pathogens.

    • Reference

    • Front Microbiol. 2016 Jul 19;7:1115.

    • Author

    • Xin B, Zheng J, Liu H, Li J, Ruan L, Peng D, Sajid M, Sun M