General Information

    • DRAMP ID

    • DRAMP18373

    • Peptide Name

    • mBD-6 (Murine beta-defensin 6)

    • Source

    • Mus musculus

    • Family

    • Belongs to the beta-defensin family.

    • Gene

    • Not found

    • Sequence

    • CMSYGGSCQRSCNGGFRLGGHCGHPKIRCCRRK

    • Sequence Length

    • 33

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Anti-Gram-

    • Target Organism

      • Gram-negative bacteria: E. coli.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18373 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18373.

Physicochemical Information

    • Formula

    • C144H236N56O40S7

    • Absent Amino Acids

    • ADETVW

    • Common Amino Acids

    • G

    • Mass

    • 3616.23

    • PI

    • 9.69

    • Basic Residues

    • 9

    • Acidic Residues

    • 0

    • Hydrophobic Residues

    • 3

    • Net Charge

    • +9

    • Boman Index

    • -8811

    • Hydrophobicity

    • -0.721

    • Aliphatic Index

    • 23.64

    • Half Life

      • Mammalian:1.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 1865

    • Absorbance 280nm

    • 58.28

    • Polar Residues

    • 18

DRAMP18373

DRAMP18373 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • A novel mouse beta-defensin, mBD-6, predominantly expressed in skeletal muscle.

    • Reference

    • J Biol Chem. 2001 Aug 24;276(34):31510-4

    • Author

    • Yamaguchi Y, Fukuhara S, Nagase T, Tomita T, Hitomi S, Kimura S, Kurihara H, Ouchi Y.