General Information

    • DRAMP ID

    • DRAMP18394

    • Peptide Name

    • NCR335 (nodule-specific cysteine-rich peptides; plants)

    • Source

    • Medicago truncatula

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • RLNTTFRPLNFKMLRFWGQNRNIMKHRGQKVHFSLILSDCKTNKDCPKLRRANVRCRKSYCVPI

    • Sequence Length

    • 64

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against S. enterica (MIC 16 uM) and L. monocytogenes (MIC 32 uM).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

    • No cytotoxicity information found in the reference(s) presented

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Cyclic

    • N-terminal Modification

    • Free

    • C-terminal Modification

    • Free

    • Nonterminal Modifications and Unusual Amino Acids

    • Disulfide bond between Cys40 and Cys61,Cys46 and Cys56.

    • Stereochemistry

    • L

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18394 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18394.

Physicochemical Information

    • Formula

    • C340H557N111O84S6

    • Absent Amino Acids

    • E

    • Common Amino Acids

    • R

    • Mass

    • 7736.22

    • PI

    • 11.27

    • Basic Residues

    • 18

    • Acidic Residues

    • 2

    • Hydrophobic Residues

    • 18

    • Net Charge

    • +16

    • Boman Index

    • -18470

    • Hydrophobicity

    • -0.716

    • Aliphatic Index

    • 70

    • Half Life

      • Mammalian:1 hour
      • Yeast:2 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 7240

    • Absorbance 280nm

    • 114.92

    • Polar Residues

    • 19

DRAMP18394

DRAMP18394 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Comparative Analysis of the Bacterial Membrane Disruption Effect of Two Natural Plant Antimicrobial Peptides.

    • Reference

    • Front Microbiol. 2017 Jan 23;8:51.

    • Author

    • Farkas A, Mar