General Information

    • DRAMP ID

    • DRAMP18406

    • Peptide Name

    • CaThi (thionin-like peptide 2; plants)

    • Source

    • Fruits, Capsicum annuum

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KEICCKELTKPVKCSSDPLCQKLCMEKEKYEDGHCFTILSKCLCMKRCNAKTLATELLA

    • Sequence Length

    • 59

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antifungal

    • Target Organism

    • Active against C. albicans CE022, C. tropicalis CE017, C. parapsilosis CE002 (IC50 10 ug/ml), C. pelliculosa 3974 (IC50 40 ug/ml), and C. mogii 4674 (IC50 20 ug/ml).

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18406 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18406.

Physicochemical Information

    • Formula

    • C285H482N76O86S11

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • KC

    • Mass

    • 6702.08

    • PI

    • 8.41

    • Basic Residues

    • 12

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 15

    • Net Charge

    • +4

    • Boman Index

    • -8737

    • Hydrophobicity

    • -0.232

    • Aliphatic Index

    • 76.1

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 34.31

    • Polar Residues

    • 19

DRAMP18406

DRAMP18406 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Thionin-like peptides from Capsicum annuum fruits with high activity against human pathogenic bacteria and yeasts.

    • Reference

    • Biopolymers. 2014 Jan;102(1):30-9.

    • Author

    • Taveira GB, Mathias LS, da Motta OV, Machado OL, Rodrigues R, Carvalho AO, Teixeira-Ferreira A, Perales J, Vasconcelos IM, Gomes VM.
  • ·Literature 2

    • Title

    • Thionin-like peptide from Capsicum annuum fruits: mechanism of action and synergism with fluconazole against Candida species.

    • Reference

    • BMC Microbiol. 2016 Jan 27;16:12.

    • Author

    • Taveira GB, Carvalho AO, Rodrigues R, Trindade FG, Da Cunha M, Gomes VM.