General Information

    • DRAMP ID

    • DRAMP18407

    • Peptide Name

    • Thionin-like peptide 1 (plants)

    • Source

    • Fruits, Capsicum annuum

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • KEICCKVPTTPFLCTNDPQCKTLCSKVNYEDGHCFDILSKCVCMNRCVQDAKTLAAELIEEEFLKQ

    • Sequence Length

    • 66

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial, Antifungal

    • Target Organism

    • Active against S. cerevisiae, C. albicans, C. tropicalis, E. coli and P. aeruginosa.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18407 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18407.

Physicochemical Information

    • Formula

    • C321H516N84O100S10

    • Absent Amino Acids

    • W

    • Common Amino Acids

    • C

    • Mass

    • 7490.75

    • PI

    • 5.22

    • Basic Residues

    • 9

    • Acidic Residues

    • 10

    • Hydrophobic Residues

    • 19

    • Net Charge

    • -1

    • Boman Index

    • -10088

    • Hydrophobicity

    • -0.169

    • Aliphatic Index

    • 74.18

    • Half Life

      • Mammalian:1.3 hour
      • Yeast:3 min
      • E.coli:2 min

    • Extinction Coefficient Cystines

    • 1990

    • Absorbance 280nm

    • 30.15

    • Polar Residues

    • 21

DRAMP18407

DRAMP18407 chydropathy plot

Comments Information

    • Comment

    • No comments found on DRAMP database

Literature Information

  • ·Literature 1

    • Title

    • Thionin-like peptides from Capsicum annuum fruits with high activity against human pathogenic bacteria and yeasts

    • Reference

    • Biopolymers. 2014 Jan;102(1):30-9.

    • Author

    • Taveira GB, Mathias LS, da Motta OV, Machado OL, Rodrigues R, Carvalho AO, Teixeira-Ferreira A, Perales J, Vasconcelos IM, Gomes VM.