General Information

    • DRAMP ID

    • DRAMP18421

    • Peptide Name

    • DefMT7 (defensin MT7; hard ticks, arachnids, arthropods, invertebrates, animals)

    • Source

    • Ixodes ricinus

    • Family

    • Belongs to the defensin family.

    • Gene

    • Not found

    • Sequence

    • GFGCPKSALSCSQQCRENNTHSGGYCNGPFNIVCSCY

    • Sequence Length

    • 37

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antiparasitic, Antimalarial

    • Target Organism

    • No MICs found in DRAMP database

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Bridge

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18421 helical wheel diagram

    • PDB ID

    • None

    • Predicted Structure

    • There is no predicted structure for DRAMP18421.

Physicochemical Information

    • Formula

    • C162H241N49O53S6

    • Absent Amino Acids

    • DMW

    • Common Amino Acids

    • C

    • Mass

    • 3933.37

    • PI

    • 7.78

    • Basic Residues

    • 3

    • Acidic Residues

    • 1

    • Hydrophobic Residues

    • 6

    • Net Charge

    • +2

    • Boman Index

    • -5540

    • Hydrophobicity

    • -0.361

    • Aliphatic Index

    • 30.79

    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 3355

    • Absorbance 280nm

    • 90.68

    • Polar Residues

    • 23

DRAMP18421

DRAMP18421 chydropathy plot

Comments Information

    • Fuction

    • The peptide showed no activity against bacteria. It showed antimalarial activity.

Literature Information

  • ·Literature 1

    • Title

    • Antiplasmodial Activity Is an Ancient and Conserved Feature of Tick Defensins.

    • Reference

    • Front Microbiol. 2016 Oct 24;7:1682.

    • Author

    • Cabezas-Cruz A, Tonk M, Bouchut A, Pierrot C, Pierce RJ, Kotsyfakis M, Rahnamaeian M, Vilcinskas A, Khalife J, Vald
  • ·Literature 2

    • Title

    • Ixodes ricinus defensins attack distantly-related pathogens.

    • Reference

    • Dev Comp Immunol. 2015 Dec;53(2):358-65.

    • Author