• DRAMP ID

    • DRAMP18423
    • Peptide Name

    • HEdefensin (arachnids, Chelicerata, arthropods, invertebrates, animals)
    • Source

    • hemolymph, Haemaphysalis longicornis
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • EEESEVAHLRVRRGFGCPLNQGACHRHCRSIRRRGGYCSGIIKQTCTCYRN
    • Sequence Length

    • 51
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Antimicrobial, Antiviral
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Bridge
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18423 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18423.
    • Formula

    • C241H393N89O71S6
    • Absent Amino Acids

    • DMW
    • Common Amino Acids

    • R
    • Mass

    • 5865.69
    • PI

    • 9.43
    • Basic Residues

    • 13
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 10
    • Net Charge

    • +9
    • Boman Index

    • -16843
    • Hydrophobicity

    • -0.814
    • Aliphatic Index

    • 53.53
    • Half Life

      • Mammalian:1 hour
      • Yeast:30 min
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 3355
    • Absorbance 280nm

    • 67.1
    • Polar Residues

    • 21

DRAMP18423

DRAMP18423 chydropathy plot
    • Fuction

    • The synthetic peptide showed virucidal activity against Langat virus (LGTV).
  • ·Literature 1
    • Title

    • Characterization and antiviral activity of a newly identified defensin-like peptide, HEdefensin, in the hard tick Haemaphysalis longicornis
    • Reference

    • Dev Comp Immunol. 2017 Mar;68:98-107
    • Author

    • Talactac MR, Yada Y, Yoshii K, Hernandez EP, Kusakisako K, Hiroki M, Galay RL, Fujisaki K, Mochizuki M, Tanaka T