General Information

    • DRAMP ID

    • DRAMP18424

    • Peptide Name

    • TLN-58 (TLN58; human cathelicidin)

    • Source

    • the lesion vesicle, skin, Homo sapiens

    • Family

    • Not found

    • Gene

    • Not found

    • Sequence

    • TLNQARGSFDISCDKDNKRFALLGDFFRKSKEKIGKEFKRIVQRIKDFLRNLVPRTES

    • Sequence Length

    • 58

    • UniProt Entry

    • No entry found

    • Protein Existence

Activity Information

    • Biological Activity

    • Antimicrobial, Antibacterial

    • Target Organism

    • Active against S. aureus, S. epidermidis, and Group A Streptococcus.

    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry

    • Cytotoxicity

      • Not included yet

    • Binding Target

    • Not found

Structure Information

    • Linear/Cyclic

    • Not included yet

    • N-terminal Modification

    • Not included yet

    • C-terminal Modification

    • Not included yet

    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet

    • Stereochemistry

    • Not included yet

    • Structure

    • Not found

    • Structure Description

    • Not found

    • Helical Wheel Diagram

    • DRAMP18424 helical wheel diagram

    • Predicted Structure

    • There is no predicted structure for DRAMP18424.

Physicochemical Information

    • Formula

    • C305H498N92O86S

    • Absent Amino Acids

    • HMWY

    • Common Amino Acids

    • KR

    • Mass

    • 6861.93

    • PI

    • 10.21

    • Basic Residues

    • 15

    • Acidic Residues

    • 8

    • Hydrophobic Residues

    • 19

    • Net Charge

    • +7

    • Boman Index

    • -18465

    • Hydrophobicity

    • -0.816

    • Aliphatic Index

    • 73.97

    • Half Life

      • Mammalian:7.2 hour
      • Yeast:>20 hour
      • E.coli:>10 hour

    • Extinction Coefficient Cystines

    • 0

    • Absorbance 280nm

    • 0

    • Polar Residues

    • 13

DRAMP18424

DRAMP18424 chydropathy plot

Comments Information

    • TLN-58 is an alternative processed form of hCAP-18, the precursor of human LL-37 and ALL-38. TLN-58 upregulated IL-17C, IL-8, IL-23, IL-1alpha, and IL-1beta mRNA and protein expression in normal human keratinocytes, similar to LL-37.

Literature Information

  • ·Literature 1

    • Title

    • TLN-58, an additional hCAP18 processing form, found in the lesion vesicle of palmoplantar pustulosis in the skin.

    • Reference

    • J Invest Dermatol. 2017 Feb;137(2):322-331

    • Author

    • Murakami M, Kameda K, Tsumoto H, Tsuda T, Masuda K, Utsunomiya R, Mori H, Miura Y, Sayama K.