• DRAMP ID

    • DRAMP18425
    • Peptide Name

    • Ocellatin-PT6 (frog, amphibians, animals)
    • Source

    • Skin Secretion, dorsal, Leptodactylus pustulatus
    • Family

    • Not found
    • Gene

    • Not found
    • Sequence

    • GVFDIIKGAGKQLIAHAMEKIAEKVGLNKDGN
    • Sequence Length

    • 32
    • UniProt Entry

    • No entry found
    • Protein Existence

    • Biological Activity

    • Not found
    • Target Organism

    • No MICs found in DRAMP database
    • Hemolytic Activity

      • No hemolysis information or data found in the reference(s) presented in this entry
    • Cytotoxicity

      • Not included yet
    • Binding Target

    • Not found
    • Linear/Cyclic

    • Not included yet
    • N-terminal Modification

    • Not included yet
    • C-terminal Modification

    • Not included yet
    • Nonterminal Modifications and Unusual Amino Acids

    • Not included yet
    • Stereochemistry

    • Not included yet
    • Structure

    • Helix
    • Structure Description

    • Not found
    • Helical Wheel Diagram

    • DRAMP18425 helical wheel diagram
    • PDB ID

    • None
    • Predicted Structure

    • There is no predicted structure for DRAMP18425.
    • Formula

    • C149H248N42O43S
    • Absent Amino Acids

    • CPRSTWY
    • Common Amino Acids

    • GK
    • Mass

    • 3365.94
    • PI

    • 8.39
    • Basic Residues

    • 6
    • Acidic Residues

    • 4
    • Hydrophobic Residues

    • 13
    • Net Charge

    • +2
    • Boman Index

    • -2742
    • Hydrophobicity

    • -0.1
    • Aliphatic Index

    • 100.61
    • Half Life

      • Mammalian:30 hour
      • Yeast:>20 hour
      • E.coli:>10 hour
    • Extinction Coefficient Cystines

    • 0
    • Absorbance 280nm

    • 0
    • Polar Residues

    • 7

DRAMP18425

DRAMP18425 chydropathy plot
    • Fuction

    • It has leishmanicidal activity.
  • ·Literature 1
    • Title

    • Characterization and Biological Activities of Ocellatin Peptides from the Skin Secretion of the Frog Leptodactylus pustulatus.
    • Reference

    • J Nat Prod. 2015 Jul 24;78(7):1495-504.
    • Author

    • Marani MM, Dourado FS, Quelemes PV, de Araujo AR, Perfeito ML, Barbosa EA, V
  • ·Literature 2
    • Title

    • Ocellatin-PT antimicrobial peptides: High-resolution microscopy studies in antileishmania models and interactions with mimetic membrane systems.
    • Reference

    • Biopolymers. 2016 Dec;105(12):873-86.
    • Author